CookSnap is coming soon — Join the waitlist →
Back to recipes

Creamy Chicken Causa

Silky mashed potatoes layered with shredded chicken, lime, and aji amarillo—Peru's beloved yellow chili paste—all served cold. Tangy, buttery, and ready in 25 minutes.

Total time
25 min
Servings
4
Calories
485
Protein
32g
Creamy Chicken Causa
freshlightperuvianchickencreamytenderweeknightdinner

Ingredients

  • 2 cups rotisserie chicken, shredded
  • 1.5 lbs yukon gold potatoes
  • 3 tbsp aji amarillo paste
  • 3 tbsp butter
  • 2 whole limes (zested + juiced)
  • 1 whole avocado
  • 2 whole hard-boiled eggs

Instructions

  1. 1

    Peel and cut potatoes into 1-inch chunks. Boil in salted water until fork-tender, ~12 minutes.

  2. 2

    Drain potatoes and return to pot. Mash with butter, aji amarillo paste, lime juice, and a pinch of salt until creamy.

  3. 3

    Divide potato mixture between serving plates, pressing gently to create a small mound on each.

  4. 4

    Top each with shredded chicken, avocado slices, and halved hard-boiled eggs.

  5. 5

    Garnish with lime zest and a crack of black pepper. Serve cold or at room temperature.

Tools you’ll need

  • large pot
  • chef's knife
  • cutting board
  • colander
  • potato masher
  • serving spoon
  • dinner plates

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.