CookSnap is coming soon — Join the waitlist →
Back to recipes

Crawfish Pie Skillet

A Cajun-spiced crawfish filling with buttery roux, peppers, and aromatics, baked in a skillet under a golden puff-pastry crust. Shrimp or crab swaps in if crawfish isn't available.

Total time
25 min
Servings
4
Calories
520
Protein
28g
Crawfish Pie Skillet
comfortindulgentcajunshrimpflakycreamytenderweeknight

Ingredients

  • 1 lb crawfish tail meat (or shrimp), thawed if frozen
  • 1 medium bell pepper (red or yellow), diced
  • ½ cup celery, diced
  • 4 tbsp butter
  • 3 tbsp all-purpose flour
  • ¾ cup heavy cream
  • 1 sheet frozen puff pastry sheet (thawed)
  • 2 tsp cajun seasoning blend

Instructions

  1. 1

    Heat butter in a 10-inch cast-iron skillet over medium heat until foaming, ~1 minute.

  2. 2

    Add diced pepper and celery; cook 3 minutes, stirring, until soft and fragrant.

  3. 3

    Sprinkle flour over the vegetables and stir constantly for 1 minute to form a roux paste.

  4. 4

    Pour in cream slowly while stirring to avoid lumps; add cajun seasoning and stir until smooth.

  5. 5

    Fold in crawfish meat and cook 2 minutes until heated through, then remove from heat.

  6. 6

    Lay thawed puff pastry over the skillet filling, tuck edges down inside, then brush top lightly with water.

  7. 7

    Bake at 400°F for 12 minutes until pastry is golden brown and puffed.

  8. 8

    Cool 2 minutes, then serve straight from the skillet with hot sauce on the side.

Tools you’ll need

  • 10-inch cast-iron skillet
  • wooden spoon
  • oven
  • baking sheet (optional, to catch drips)

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.