CookSnap is coming soon — Join the waitlist →

Cottage Cheese Bowl with Honey

A 2-minute snack of creamy cottage cheese drizzled with honey and topped with crunchy granola. Sweet, satisfying, and no cooking required.

Total time
5 min
Servings
1
Calories
280
Protein
18g
Cottage Cheese Bowl with Honey
quicksimplevegetariancheesecreamycrunchysnackbowl

Ingredients

  • 1 cup cottage cheese
  • 1.5 tablespoons honey
  • ¼ cup granola
  • ½ cup fresh berries (blueberries, strawberries, or raspberries)

Instructions

  1. 1

    Scoop 1 cup of cottage cheese into a bowl, spreading it evenly across the bottom and sides so it fills the bowl completely.

  2. 2

    Drizzle 1.5 tablespoons of honey directly over the cottage cheese in a thin zigzag pattern, covering as much surface area as you can.

  3. 3

    Sprinkle 0.25 cup of granola evenly over the honey-drizzled cottage cheese, breaking up any large clumps as you go.

  4. 4

    Scatter 0.5 cup of fresh berries on top in a single layer, distributing them evenly across the bowl.

  5. 5

    Eat immediately while the granola is still crunchy and the honey is warm and liquid.

Tools you’ll need

  • bowl
  • spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.