CookSnap is coming soon — Join the waitlist →
Back to recipes

Cold Pesto Pasta Salad

A bright, herbaceous pasta salad loaded with fresh basil pesto, cherry tomatoes, and creamy mozzarella. Perfect for lunch boxes, picnics, or light summer dinners.

Total time
20 min
Servings
4
Calories
520
Protein
18g
Cold Pesto Pasta Salad
lightfreshsimpleitalianvegetarianvegetariancreamytender

Ingredients

  • 12 oz pasta (penne or rotini)
  • 2 cups fresh basil
  • 2 cloves garlic, minced
  • ½ cup olive oil
  • 1.5 cups cherry tomatoes, halved
  • 8 oz fresh mozzarella, torn into bite-sized pieces
  • 1 pinch salt and black pepper to taste

Instructions

  1. 1

    Boil salted water in a large pot. Add pasta and cook until al dente, ~10 minutes. Drain and set aside to cool.

  2. 2

    Combine basil, garlic, olive oil, salt, and pepper in a food processor. Pulse until smooth and creamy.

  3. 3

    Transfer cooled pasta to a large bowl. Pour pesto over and toss until every strand is coated.

  4. 4

    Add cherry tomatoes and mozzarella. Toss gently to combine. Taste and adjust salt and pepper.

  5. 5

    Chill until ready to serve, or serve at room temperature within 2 hours.

Tools you’ll need

  • large pot
  • colander
  • food processor
  • large mixing bowl
  • spoon or tongs

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.