CookSnap is coming soon — Join the waitlist →
Back to recipes

Cold Buckwheat Noodles with Tororo Dipping Sauce

Silky tororo (grated yam) dipping sauce turns simple cold soba into a luxe weeknight dinner. Serve with pickled cucumbers and a drizzle of nutty dashi broth.

Total time
20 min
Servings
2
Calories
320
Protein
12g
Cold Buckwheat Noodles with Tororo Dipping Sauce
freshlightsimplejapanesevegetariandairy-freevegetariansilky

Ingredients

  • 8 oz buckwheat soba noodles
  • 1 cup dashi broth (or instant dashi powder mixed with water)
  • 3 tbsp soy sauce
  • 1 tbsp mirin (or honey as substitute)
  • 4 oz Japanese mountain yam (tororo), peeled and grated
  • ½ cup pickled cucumbers (or quick-pickled), sliced
  • 1 sheet nori seaweed (optional), cut into thin strips

Instructions

  1. 1

    Bring a pot of salted water to a boil. Add soba and cook until al dente, stirring gently, ~3 minutes.

  2. 2

    Drain soba and rinse under cold running water until completely cool. Shake dry and divide between two bowls.

  3. 3

    Whisk dashi, soy sauce, and mirin in a small bowl until combined. Pour into two small dipping cups.

  4. 4

    Stir grated yam into each dipping cup until smooth and frothy — this is the tororo sauce.

  5. 5

    Top each noodle bowl with pickled cucumbers and nori strips. Serve with tororo dipping sauce on the side.

Tools you’ll need

  • large pot
  • colander
  • small mixing bowl
  • whisk
  • two small dipping cups or bowls
  • fine grater (microplane or box grater)

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.