CookSnap is coming soon — Join the waitlist →
Back to recipes

Cold Buckwheat Noodles with Clam Broth

Chilled soba noodles served with a savory clam dipping broth, wasabi, and green onions—a light, elegant dinner ready in under 15 minutes. Authentic Japanese comfort that feels like a restaurant meal at home.

Total time
12 min
Servings
2
Calories
220
Protein
8g
Cold Buckwheat Noodles with Clam Broth
lightelegantfreshjapanesevegetariantenderchewyweeknight

Ingredients

  • 8 oz dried soba noodles
  • 1.5 cups clam dipping broth (bottled or jarred)
  • 4 cups water for ice bath
  • 2 cups ice cubes
  • 3 tbsp fresh green onions, sliced thin
  • 1 tsp wasabi paste

Instructions

  1. 1

    Bring a large pot of salted water to a rolling boil over high heat, about 5 minutes.

  2. 2

    Add soba noodles and cook until just tender, stirring occasionally, 4–5 minutes. Don't overcook—they should have a slight bite.

  3. 3

    Drain noodles and rinse under cold running water until completely chilled, about 1 minute, shaking off excess water.

  4. 4

    Warm clam broth gently in the same pot over medium heat—you're aiming for warm, not hot, about 2 minutes.

  5. 5

    Divide chilled noodles between two bowls. Top each with a pinch of green onions and a dab of wasabi on the side.

  6. 6

    Pour warm clam broth into small dipping cups alongside each bowl. Dip noodles into broth before eating.

Tools you’ll need

  • large pot (5+ quarts)
  • wooden spoon or chopsticks
  • colander
  • two medium bowls
  • two small cups or bowls for dipping broth

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.