CookSnap is coming soon — Join the waitlist →
Back to recipes

Clay Pot Crispy Rice with Caramelized Chicken

Vietnamese-style clay pot rice with caramelized chicken thighs, a shatteringly crispy bottom crust, and a savory-sweet glaze. Everything cooks in one skillet in under 25 minutes.

Total time
25 min
Servings
2
Calories
580
Protein
38g
Clay Pot Crispy Rice with Caramelized Chicken
comfortsatisfyingvietnamesechickencrispytenderjuicyweeknight

Ingredients

  • 1 lb boneless chicken thighs, cut into bite-sized pieces
  • 2 cups cooked jasmine rice (day-old or freshly cooked and cooled)
  • 2 tbsp fish sauce
  • 1 tbsp granulated sugar
  • 2 medium shallots, thinly sliced
  • 3 cloves garlic cloves, minced
  • 3 tbsp neutral cooking oil, divided
  • 3 stalks scallions, cut into 1-inch pieces

Instructions

  1. 1

    Heat 1 tbsp oil in a 12-inch non-stick or cast-iron skillet over medium-high heat until shimmering, ~60 seconds.

  2. 2

    Add chicken pieces and cook without stirring for 3 minutes until golden, then toss and cook 2 more minutes until cooked through.

  3. 3

    Push chicken to the side. Add shallots and garlic to the empty space, stir until fragrant, ~90 seconds.

  4. 4

    Stir fish sauce and sugar into the chicken. Toss everything together for 30 seconds until the mixture becomes glossy and caramelized.

  5. 5

    Transfer the chicken mixture to a plate. Reduce heat to medium and add remaining 2 tbsp oil to the skillet.

  6. 6

    Add rice in an even layer, pressing gently. Don't stir—let it sit for 6 minutes until a golden, crispy crust forms on the bottom.

  7. 7

    Scatter the caramelized chicken and scallions over the rice. Drizzle with a splash of water, cover, and cook 2 minutes until scallions soften.

  8. 8

    Serve directly from the skillet, scraping up the crispy bits from the bottom.

Tools you’ll need

  • 12-inch non-stick or cast-iron skillet with lid
  • cutting board
  • chef's knife
  • wooden spoon or spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.