CookSnap is coming soon — Join the waitlist →
Back to recipes

Clay Pot Chicken & Sausage Rice

Crispy-bottomed jasmine rice layered with chicken, Chinese sausage, and aromatics, finished with a savory caramelized soy glaze. Cooked entirely in one pot for maximum flavor and minimal cleanup.

Total time
28 min
Servings
2
Calories
680
Protein
42g
Clay Pot Chicken & Sausage Rice
comfortsatisfyingvietnamesechickenporkcrispytenderfluffy

Ingredients

  • 1.5 cups jasmine rice
  • ¾ lb boneless chicken thighs, cut into bite-sized pieces
  • 4 oz Chinese sausage (lap cheong), sliced thin
  • ½ medium yellow onion, diced
  • 3 tbsp soy sauce
  • 2 stalks scallions, chopped (white and green separated)
  • 2 tbsp neutral cooking oil

Instructions

  1. 1

    Rinse rice under cold water until water runs clear, then drain. Add 2.25 cups water to a clay pot or heavy skillet.

  2. 2

    Bring water to a boil over medium-high heat, then add rice. Stir once, lower heat to medium-low, and cover tightly.

  3. 3

    While rice cooks, heat oil in a separate skillet over medium-high. Brown chicken pieces, breaking up clumps, until edges turn golden, about 4 minutes.

  4. 4

    Add sausage and diced onion to the chicken. Stir for 2 minutes until sausage releases its oil and onion softens.

  5. 5

    Pour soy sauce over the chicken mixture and stir. After rice has cooked about 12 minutes total, scatter the chicken mixture on top without stirring.

  6. 6

    Re-cover the pot and cook 3 more minutes. Remove from heat, fluff rice gently with a fork, top with scallion whites and greens, and serve hot.

Tools you’ll need

  • clay pot or 12-inch heavy skillet with lid
  • 8-inch skillet
  • wooden spoon
  • fork

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.