CookSnap is coming soon — Join the waitlist →

Classic Tuna Melt

Crispy bread, melted cheese, and warm tuna salad come together in this timeless American sandwich. Ready in 15 minutes.

Total time
15 min
Servings
2
Calories
485
Protein
28g
Classic Tuna Melt
comfortcasualamericanfishcrispymeltytenderweeknight

Ingredients

  • 1 can canned tuna (5 oz), drained
  • 3 tablespoons mayonnaise
  • 4 slices white bread or English muffins
  • 4 slices cheddar or American cheese
  • 2 tablespoons butter
  • ¼ teaspoon salt and pepper

Instructions

  1. 1

    Open the can of tuna and pour it into a fine-mesh strainer held over a bowl or sink; press gently with the back of a fork to squeeze out as much liquid as possible.

  2. 2

    Transfer the drained tuna to a small bowl and stir in 3 tablespoons of mayonnaise, a pinch of salt, and a pinch of pepper until evenly combined.

  3. 3

    Spread half of the tuna mixture (about 2.5 tablespoons) onto the top surface of two bread slices, dividing evenly between them.

  4. 4

    Place one cheese slice on top of the tuna on each sandwich, laying it flat so it covers the tuna completely.

  5. 5

    Top each sandwich with a second bread slice, pressing down gently so the slices adhere.

  6. 6

    Place a 12-inch skillet over medium-high heat and add 1 tablespoon of butter, tilting the pan so the butter melts and coats the bottom evenly, about 45 seconds.

  7. 7

    Once the butter stops foaming and smells nutty, carefully lay both sandwiches flat in the skillet without overlapping.

  8. 8

    Cook the first side without moving the sandwiches until the bread turns the color of warm honey and feels firm when you press the edge with your spatula, about 3 minutes.

  9. 9

    Remove the skillet from heat and add the remaining 1 tablespoon of butter, tilting to coat the hot surface.

  10. 10

    Use a thin spatula to slide underneath one sandwich and flip it onto the buttered surface; repeat with the second sandwich.

  11. 11

    Return the skillet to medium-high heat and cook the second side until the bread turns golden honey-brown and the cheese inside is melted (peek at the edge to check), about 2 to 3 minutes.

  12. 12

    Slide both sandwiches onto a cutting board or serving plate and let them rest for 1 minute before eating so the cheese sets slightly.

Tools you’ll need

  • 12-inch skillet
  • fine-mesh strainer
  • small bowl
  • fork
  • thin metal spatula
  • cutting board

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.