CookSnap is coming soon — Join the waitlist →
Back to recipes

Classic Niçoise Salad

A French-inspired salad with tender potatoes, green beans, hard-boiled eggs, and canned tuna, dressed simply with lemon and olive oil. Ready in 20 minutes.

Total time
20 min
Servings
2
Calories
385
Protein
28g
Classic Niçoise Salad
freshlightfrenchmediterraneanfishtendercrispyweeknight

Ingredients

  • 12 oz potatoes, waxy (fingerling or baby gold)
  • 6 oz green beans, fresh
  • 2 large eggs
  • 1 can (5 oz) canned tuna in water
  • 4 cups mixed greens (lettuce, arugula)
  • 1 lemon + 3 tbsp oil lemon (juiced) and extra virgin olive oil
  • 1 to taste salt and black pepper

Instructions

  1. 1

    Boil potatoes in salted water until tender, about 12 minutes. Drain and let cool slightly.

  2. 2

    Boil green beans in the same pot until bright green and just tender, 5 minutes. Drain.

  3. 3

    Boil eggs in the same pot for 8 minutes. Transfer to ice water, cool, then peel and halve.

  4. 4

    Arrange mixed greens on a serving plate. Top with cooled potatoes, green beans, and eggs.

  5. 5

    Drain tuna and flake it over the salad in a loose cluster.

  6. 6

    Whisk lemon juice with olive oil, salt, and pepper. Drizzle over the salad.

  7. 7

    Serve immediately.

Tools you’ll need

  • medium pot
  • slotted spoon
  • cutting board
  • small bowl for dressing
  • whisk

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.