Classic Caesar Salad
Crisp romaine with a tangy, garlicky Caesar dressing made in seconds. Top with crunchy croutons and parmesan for a restaurant-quality salad in under 15 minutes.
- Total time
- 12 min
- Servings
- 2
- Calories
- 280
- Protein
- 8g
freshlightmediterraneanvegetariancrispycrunchyweeknightlunch
Ingredients
- 1 head romaine lettuce, 1 head
- ½ cup, shaved or grated parmesan cheese
- 1 cup croutons
- 1 clove garlic, minced
- 1 lemon lemon, juiced
- ¼ cup olive oil
- 1 to taste salt and pepper
Instructions
- 1
Chop romaine into bite-sized pieces. Rinse and pat dry thoroughly.
- 2
Whisk minced garlic with lemon juice in a large bowl until combined.
- 3
Add olive oil to the garlic-lemon mixture and whisk until emulsified.
- 4
Add romaine to the bowl with dressing and toss until every leaf glistens.
- 5
Season with salt and pepper to taste.
- 6
Top with croutons and shaved parmesan. Serve immediately.
Tools you’ll need
- cutting board
- sharp knife
- large mixing bowl
- whisk
- vegetable spinner or paper towels
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
