Classic Caesar Salad
Crisp romaine tossed with a tangy, garlicky dressing made from scratch and topped with crunchy croutons and sharp Parmesan. Ready in 15 minutes.
- Total time
- 15 min
- Servings
- 4
- Calories
- 285
- Protein
- 9g

freshlightmediterraneanvegetariancrispycrunchySaladweeknight
Ingredients
- 1 head romaine lettuce, chopped
- ½ cup Parmesan cheese, finely grated
- 2 cloves garlic, minced
- 3 tbsp lemon juice
- 1 tsp anchovy paste or Worcestershire sauce
- 1.5 cups croutons, store-bought or homemade
Instructions
- 1
Whisk together minced garlic, lemon juice, anchovy paste, 0.5 tsp salt, and black pepper in a small bowl.
- 2
Slowly whisk in 5 tbsp olive oil until the dressing emulsifies and looks creamy.
- 3
Toss chopped romaine with dressing in a large bowl until every leaf is coated evenly.
- 4
Divide salad among serving bowls. Top with croutons and grated Parmesan.
- 5
Serve immediately.
Tools you’ll need
- small mixing bowl
- whisk
- large mixing bowl
- serving bowls
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.



