CookSnap is coming soon — Join the waitlist →

Classic BLT Sandwich

Crispy bacon, fresh lettuce, ripe tomato, and creamy mayo on toasted bread—a timeless sandwich that's all about quality ingredients and perfect assembly. Ready in under 10 minutes.

Total time
8 min
Servings
1
Calories
385
Protein
12g
Classic BLT Sandwich
casualquickamericancrispytenderweeknightlunchsandwich

Ingredients

  • 3 strips bacon strips
  • 2 slices bread, sliced
  • 1.5 tablespoons mayonnaise
  • 2 leaves lettuce leaves (crisp varieties like romaine or iceberg)
  • ½ medium tomato, ripe
  • 0 to taste salt and pepper

Instructions

  1. 1

    Place the 3 bacon strips side by side in a cold skillet, leaving a tiny gap between each one so they do not overlap.

  2. 2

    Turn the heat to medium and cook the bacon until the edges curl and darken from pale pink to deep brown, about 5 to 6 minutes, turning once with tongs halfway through.

  3. 3

    Slide the cooked bacon onto a paper towel and let cool for 30 seconds while you finish assembling.

  4. 4

    Place both bread slices in the toaster and push the lever down; toast until the surface is golden brown and feels firm when you tap it, about 2 to 3 minutes.

  5. 5

    Spread 1 and a half tablespoons of mayonnaise evenly across the inside surface of both warm toast slices using a butter knife, working to cover every corner.

  6. 6

    Lay the 2 lettuce leaves flat on top of the mayonnaise on the bottom slice of toast, overlapping them to cover the bread with no gaps.

  7. 7

    Slice the half tomato into 2 or 3 thin rounds, cutting straight down through the tomato from top to bottom.

  8. 8

    Arrange the tomato slices in a single overlapping layer on top of the lettuce, covering as much area as possible.

  9. 9

    Lay the 3 cooled bacon strips side by side in a single layer on top of the tomato, covering it from edge to edge.

  10. 10

    Sprinkle a tiny pinch of salt and a few grinds of pepper across the bacon.

  11. 11

    Press the top toast slice down onto the bacon firmly so the sandwich holds together as one unit, then cut the sandwich in half diagonally from corner to corner using a serrated knife.

  12. 12

    Transfer both halves to a plate and serve immediately while the toast is still warm.

Tools you’ll need

  • 12-inch skillet
  • tongs
  • paper towels
  • toaster
  • butter knife
  • cutting board
  • serrated knife
  • plate

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.