Cinnamon Sugar Tortilla Chips
Crispy, sweet tortilla strips tossed in cinnamon and sugar—ready in 10 minutes with zero oven time. A satisfying snack that tastes like dessert.
- Total time
- 10 min
- Servings
- 2
- Calories
- 180
- Protein
- 2g
simpleindulgentvegetariancrispysnacksnacksnackpan-fried
Ingredients
- 2 whole flour tortillas (6–8 inch)
- 2 tbsp sugar
- ½ tsp ground cinnamon
- 2 tbsp olive oil
Instructions
- 1
Stack tortillas and cut into triangles using a knife or pizza cutter.
- 2
Mix cinnamon and sugar in a small bowl.
- 3
Heat oil in a skillet over medium-high until it shimmers, about 1 minute.
- 4
Add tortilla triangles in a single layer and cook until edges curl and color deepens, 2–3 minutes per side.
- 5
Transfer to a paper towel–lined plate while still warm.
- 6
Sprinkle cinnamon-sugar mixture over hot chips and toss to coat evenly.
- 7
Serve immediately while crispy.
Tools you’ll need
- 12-inch skillet
- cutting board
- knife or pizza cutter
- small bowl
- paper towels
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
