CookSnap is coming soon — Join the waitlist →
Back to recipes

Cholar Dal with Crispy Coconut

Sweet and savory Bengali chickpea curry spiked with ginger and mustard, topped with toasted coconut for crunch. Ready in 20 minutes with canned chickpeas.

Total time
20 min
Servings
4
Calories
310
Protein
12g
Cholar Dal with Crispy Coconut
comfortwholesomeindianvegetarianveganchickpeascreamycrunchy

Ingredients

  • ½ cup coconut flakes, unsweetened
  • 2 tbsp vegetable oil
  • 1 tsp yellow mustard seeds
  • 1 tbsp fresh ginger, minced
  • 2 cans (15 oz each) canned chickpeas, drained and rinsed
  • 2 tbsp grated jaggery or brown sugar
  • 2 whole green chiles, minced (or 1/2 tsp red pepper flakes)
  • ¾ cup coconut milk (light or full-fat)

Instructions

  1. 1

    Toast coconut flakes in a dry skillet over medium heat until golden and fragrant, ~3 minutes. Transfer to a bowl.

  2. 2

    Return skillet to medium-high with oil. Add mustard seeds; cook until they pop and darken, ~1 minute.

  3. 3

    Stir in ginger and green chiles. Cook until fragrant, 30 seconds, then add chickpeas and jaggery.

  4. 4

    Pour in coconut milk and stir. Simmer over medium heat until flavors meld and sauce thickens slightly, ~5 minutes.

  5. 5

    Taste and adjust salt, pepper, and spice to your liking.

  6. 6

    Divide into bowls and top generously with toasted coconut. Serve hot with rice or bread.

Tools you’ll need

  • 12-inch skillet or saucepan
  • wooden spoon
  • measuring spoons and cups

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.