CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Chocolate Covered Frozen Banana Bites

Ripe bananas sliced, frozen, and dipped in melted chocolate for an easy no-bake snack. Ready to eat in minutes with zero cleanup.

Total time
12 min
Servings
4
Calories
185
Protein
1g
Chocolate Covered Frozen Banana Bites
simpleindulgentvegetariancreamycrispysnackappetizersnack

Ingredients

  • 2 whole ripe bananas
  • ¾ cup chocolate chips (semi-sweet or dark)
  • ½ tbsp coconut oil or vegetable oil
  • ¼ tsp sea salt or fleur de sel (optional garnish)

Instructions

  1. 1

    Peel bananas and slice into 1-inch rounds on a cutting board.

  2. 2

    Arrange banana slices on a parchment-lined tray in a single layer.

  3. 3

    Freeze for 5 minutes until firm enough to handle but not rock-solid.

  4. 4

    Heat chocolate chips and coconut oil in a microwave-safe bowl in 30-second pulses, stirring between each, until just melted and smooth.

  5. 5

    Dip each frozen banana slice into melted chocolate, letting excess drip off, then place back on the parchment.

  6. 6

    Sprinkle with salt if desired. Freeze for 2 minutes until chocolate sets.

  7. 7

    Serve immediately or store in an airtight container in the freezer up to 1 week.

Tools you’ll need

  • cutting board
  • knife
  • parchment paper
  • sheet tray
  • microwave-safe bowl
  • spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.