CookSnap is coming soon — Join the waitlist →
Back to recipes

Chilled Buckwheat Noodles with Crispy Egg

Korean mak guksu — chewy buckwheat noodles tossed in tangy, umami-rich dipping sauce and topped with a crispy fried egg. Ready in 20 minutes.

Total time
20 min
Servings
2
Calories
420
Protein
14g
Chilled Buckwheat Noodles with Crispy Egg
freshlightkoreanvegetarianeggschewycrispyweeknight

Ingredients

  • 200 g buckwheat noodles (or soba)
  • 3 tbsp soy sauce
  • 2 tbsp rice vinegar
  • 1 tbsp sesame oil
  • ½ tsp gochugaru (Korean red chili flakes)
  • 1 medium cucumber
  • 2 whole eggs
  • 1 stalk green onion

Instructions

  1. 1

    Boil salted water in a large pot. Add buckwheat noodles and cook until tender, ~8 minutes. Drain and rinse under cold water until chilled.

  2. 2

    While noodles cook, whisk soy sauce, rice vinegar, sesame oil, and gochugaru in a small bowl. Set the sauce aside.

  3. 3

    Slice cucumber into thin half-moons. Thinly slice green onion on the bias.

  4. 4

    Heat 1 tbsp oil in a skillet over medium-high until it shimmers. Crack eggs into the pan and fry until whites are set but yolks jiggle, ~3 minutes.

  5. 5

    Toss chilled noodles with the dipping sauce and half the cucumber in a bowl. Transfer to serving bowls.

  6. 6

    Top each bowl with a fried egg, remaining cucumber, and green onion. Serve immediately.

Tools you’ll need

  • large pot
  • colander
  • small mixing bowl
  • 12-inch skillet
  • tongs or slotted spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.