CookSnap is coming soon — Join the waitlist →
Back to recipes

Chili Oil Chicken (Kou Shui Ji)

Poached chicken dressed in fragrant Sichuan chili oil with numbing peppercorns, garlic, and scallions. Ready in 20 minutes and tastes like a restaurant showstopper.

Total time
20 min
Servings
2
Calories
420
Protein
38g
Chili Oil Chicken (Kou Shui Ji)
casualboldchinesechickentendercrispyweeknightmain-dish

Ingredients

  • 1 lb boneless, skinless chicken breasts
  • ½ cup neutral oil (vegetable or peanut)
  • 2 tbsp chili flakes (or chili powder)
  • 1 tbsp Sichuan peppercorns
  • 4 cloves garlic, minced
  • 4 stalks scallions, cut into 2-inch pieces
  • 2 tbsp soy sauce

Instructions

  1. 1

    Bring salted water to a boil in a pot. Add chicken, reduce heat to low, and poach until cooked through, ~12 minutes.

  2. 2

    Transfer chicken to a cutting board. Once cool, slice into 1/4-inch strips and arrange on a serving plate.

  3. 3

    Toast Sichuan peppercorns in a dry skillet over medium heat for 1 minute until fragrant. Transfer to a small bowl.

  4. 4

    Heat oil in the same skillet over medium. Add chili flakes and toast for 30 seconds until the oil turns deep red.

  5. 5

    Pour hot oil over garlic and scallions in a bowl. Stir in soy sauce and toasted peppercorns.

  6. 6

    Drizzle chili oil and peppercorns over sliced chicken. Serve immediately while oil is still warm.

Tools you’ll need

  • pot (3-quart minimum)
  • cutting board
  • chef's knife
  • 12-inch skillet
  • small bowl
  • spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.