CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Chili Crisp Pork Pad Prik King

Tender pork seared with long beans in a spicy-herbal red curry paste sauce, finished with a swirl of chili crisp. Pure TikTok magic in one skillet, 20 minutes flat.

Total time
20 min
Servings
2
Calories
385
Protein
32g
Chili Crisp Pork Pad Prik King
satisfyingboldthaiporktendercrispyweeknightmain-dish

Ingredients

  • ¾ lb pork shoulder or pork butt, thinly sliced
  • 8 oz long beans or green beans, cut into 2-inch pieces
  • 3 tbsp red curry paste
  • ½ cup coconut milk
  • 1 whole lime (juiced)
  • 1 tbsp chili crisp (or sambal oelek)
  • ¼ cup fresh basil leaves (Thai or Italian)

Instructions

  1. 1

    Heat 1 tbsp oil in a 12-inch skillet over medium-high until shimmering.

  2. 2

    Add pork, spread in a single layer, don't stir for 2 minutes until edges brown.

  3. 3

    Stir, break into smaller pieces, cook 2 more minutes until no pink remains.

  4. 4

    Stir in red curry paste, cook 1 minute until fragrant and the paste darkens.

  5. 5

    Add long beans and coconut milk, toss to coat, simmer 5 minutes until beans are tender-crisp.

  6. 6

    Squeeze lime juice over the top, stir in basil, drizzle with chili crisp, serve immediately.

Tools you’ll need

  • 12-inch stainless steel or cast-iron skillet
  • wooden spoon or silicone spatula
  • cutting board
  • chef's knife
  • microplane or box grater (for lime zest, optional)

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.