CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Chili Crisp Avocado Toast with Everything

Creamy smashed avocado on crispy toast, topped with chili crisp, everything seasoning, and a squeeze of lime. Potato chips on the side make it a proper snack.

Total time
5 min
Servings
1
Calories
280
Protein
7g
Chili Crisp Avocado Toast with Everything
quicksatisfyingcalifornianvegetarianvegancrispycreamysnack

Ingredients

  • 1 slice bread, thick-cut
  • ½ whole avocado, ripe
  • 1 tbsp chili crisp
  • ½ tsp everything bagel seasoning
  • ¼ whole lime
  • 1 handful potato chips

Instructions

  1. 1

    Toast the bread until golden brown and crispy, 2–3 minutes.

  2. 2

    Scoop the avocado onto the toast and smash it with the back of a fork until chunky-creamy.

  3. 3

    Drizzle chili crisp over the avocado, then sprinkle everything seasoning on top.

  4. 4

    Squeeze lime juice over the toast and serve with a handful of potato chips on the side.

Tools you’ll need

  • toaster or toaster oven
  • fork

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.