Chili Crisp Avocado Toast with Everything
Creamy smashed avocado on crispy toast, topped with chili crisp, everything seasoning, and a squeeze of lime. Potato chips on the side make it a proper snack.
- Total time
- 5 min
- Servings
- 1
- Calories
- 280
- Protein
- 7g
quicksatisfyingcalifornianvegetarianvegancrispycreamysnack
Ingredients
- 1 slice bread, thick-cut
- ½ whole avocado, ripe
- 1 tbsp chili crisp
- ½ tsp everything bagel seasoning
- ¼ whole lime
- 1 handful potato chips
Instructions
- 1
Toast the bread until golden brown and crispy, 2–3 minutes.
- 2
Scoop the avocado onto the toast and smash it with the back of a fork until chunky-creamy.
- 3
Drizzle chili crisp over the avocado, then sprinkle everything seasoning on top.
- 4
Squeeze lime juice over the toast and serve with a handful of potato chips on the side.
Tools you’ll need
- toaster or toaster oven
- fork
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
