CookSnap is coming soon — Join the waitlist →
Back to recipes

Chile Gravy Beef Enchiladas

Seasoned ground beef rolled in tortillas and baked in spicy red chile sauce—ready in 20 minutes flat. Comfort-food Tex-Mex that tastes like you simmered it all day.

Total time
20 min
Servings
4
Calories
520
Protein
32g
Chile Gravy Beef Enchiladas
comfortsatisfyingtex-mexbeeftendermeltyweeknightenchilada

Ingredients

  • 1 lb ground beef
  • 2 cups red chile sauce (canned enchilada sauce or homemade)
  • 8 count flour tortillas (8-inch)
  • 1.5 cups shredded cheddar cheese
  • ½ medium yellow onion, diced
  • 1 tsp cumin

Instructions

  1. 1

    Preheat oven to 425°F. Brown ground beef in a large skillet over medium-high with diced onion, breaking up meat with a spoon, until no pink remains, ~6 minutes.

  2. 2

    Stir in cumin, salt, and pepper. Remove from heat. Spread 1/2 cup chile sauce across the bottom of a 9x13 baking dish.

  3. 3

    Warm tortillas in the skillet 30 seconds per side so they don't tear. Fill each with 3 tbsp beef mixture and 1 tbsp cheese, then roll tight.

  4. 4

    Place seam-side down in the baking dish. Pour remaining chile sauce over the top, then scatter remaining cheese over all.

  5. 5

    Bake until cheese bubbles and edges are golden, 10–12 minutes. Let rest 2 minutes before serving.

Tools you’ll need

  • 12-inch skillet
  • 9x13-inch baking dish
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.