CookSnap is coming soon — Join the waitlist →
Back to recipes

Chilaquiles Verdes with Chicken

Crispy tortilla chips baked with tangy green salsa, topped with shredded chicken and melted cheese. A complete breakfast that comes together in one skillet in under 25 minutes.

Total time
25 min
Servings
2
Calories
520
Protein
38g
Chilaquiles Verdes with Chicken
comfortcasualmexicanchickencrispymeltyweeknightbreakfast

Ingredients

  • 1.5 cups cooked shredded chicken
  • 1.5 cups salsa verde (jarred or fresh)
  • 3 cups tortilla chips (unflavored)
  • ¾ cup shredded Oaxaca or mozzarella cheese
  • ¼ cup diced white onion
  • 2 tablespoons fresh cilantro, chopped

Instructions

  1. 1

    Preheat the oven to 400°F and position the rack in the middle. Wait for the indicator light to turn off or the beep to sound, confirming the oven is fully heated.

  2. 2

    Cut the white onion in half from root to tip, then place each half flat-side down on the cutting board and slice crosswise into thin half-moons about 1/8-inch thick.

  3. 3

    Pinch off the cilantro leaves from the stems into a small pile, then use a knife to roughly chop them until the leaves are in small, uneven pieces.

  4. 4

    Pour the 1.5 cups salsa verde into a 10-inch skillet and set the skillet on the stovetop over medium heat, stirring occasionally with a wooden spoon, until the salsa just begins to bubble at the edges, about 2 minutes.

  5. 5

    Remove the skillet from the heat. Add the 3 cups tortilla chips and the 1.5 cups shredded chicken to the skillet and stir with a wooden spoon until the chips are evenly coated with salsa, about 30 seconds.

  6. 6

    Sprinkle the 0.75 cup shredded cheese evenly over the top of the mixture in a single layer, covering as much surface as possible.

  7. 7

    Slide the skillet into the preheated 400°F oven on the middle rack and bake until the cheese is melted and bubbly with just a few light brown spots, about 8 minutes.

  8. 8

    Remove the skillet from the oven using an oven mitt and place it on a heat-safe surface. Scatter the diced onion and chopped cilantro evenly over the top.

  9. 9

    Divide the chilaquiles between two bowls, scooping from the skillet with a spoon to ensure both servings get chips, sauce, and cheese.

Tools you’ll need

  • 10-inch cast iron skillet or oven-safe skillet
  • wooden spoon
  • cutting board
  • chef's knife
  • oven mitt

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.