CookSnap is coming soon — Join the waitlist →
Back to recipes

Chicken Quesadilla

Crispy-edged quesadilla with seasoned chicken, melted cheese, and fresh cilantro. Ready in 15 minutes—perfect for a quick lunch or dinner.

Total time
15 min
Servings
2
Calories
520
Protein
35g
Chicken Quesadilla
quickcasualmexicanchickencrispymeltyweeknightquesadilla

Ingredients

  • 1.5 cups cooked chicken, shredded
  • 4 count large flour tortillas
  • 1 cup shredded cheddar or oaxaca cheese
  • ¼ cup fresh cilantro, chopped
  • 1 tbsp olive oil
  • 1 pinch salt and pepper to taste

Instructions

  1. 1

    Toss shredded chicken with cilantro, salt, and pepper.

  2. 2

    Lay one tortilla flat. Scatter half the cheese over half of it.

  3. 3

    Pile chicken mixture on top of the cheese in an even layer.

  4. 4

    Top with remaining cheese, then fold tortilla in half to seal.

  5. 5

    Heat oil in a large skillet over medium-high until shimmering, ~90 seconds.

  6. 6

    Slide quesadilla into pan. Cook 2 minutes until the bottom edges turn golden brown.

  7. 7

    Flip carefully. Cook another 2 minutes until cheese melts and bottom is crispy.

  8. 8

    Slide onto a cutting board. Repeat with remaining tortillas and fillings.

  9. 9

    Cut each quesadilla into triangles. Serve immediately.

Tools you’ll need

  • large skillet (12-inch)
  • cutting board
  • knife
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.