CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Chicken Nasi Goreng

Fragrant fried rice with seared chicken, shrimp paste, and bright lime finish. A complete Indonesian dinner ready in under 45 minutes.

Total time
45 min
Servings
4
Calories
520
Protein
28g
Chicken Nasi Goreng
satisfyingcasualindonesianchickenshrimptenderfragrantweeknight

Ingredients

  • 1.25 lb boneless chicken thighs
  • 3 cups cooked white rice, cooled
  • 1.5 tbsp shrimp paste (belacan)
  • 3 tbsp soy sauce
  • 4 cloves garlic, minced
  • 2 whole red chilies, sliced thin
  • 1 whole lime (juiced)
  • 4 stalks green onions, sliced
  • 3 tbsp vegetable oil

Instructions

  1. 1

    Cut chicken into 1-inch cubes. Season with salt and black pepper.

  2. 2

    Stir shrimp paste with soy sauce and 2 tbsp water until smooth.

  3. 3

    Heat 2 tbsp oil in a large skillet over medium-high heat until shimmering, ~90 seconds.

  4. 4

    Add chicken and cook without stirring for 3 minutes until golden on one side.

  5. 5

    Stir and cook 2 more minutes until cooked through. Transfer to a plate.

  6. 6

    Add remaining 1 tbsp oil to the skillet. Add garlic and chilies, cook 30 seconds until fragrant.

  7. 7

    Add shrimp paste mixture and stir for 30 seconds to combine.

  8. 8

    Add rice, breaking up clumps, and stir constantly for 3-4 minutes until grains separate and edges begin to brown.

  9. 9

    Return chicken to skillet. Stir in lime juice and most of the green onions.

  10. 10

    Serve hot. Top with remaining green onions.

Tools you’ll need

  • large skillet (12-inch)
  • wooden spoon
  • cutting board
  • chef's knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.