CookSnap is coming soon — Join the waitlist →
Back to recipes

Cheesy Potato Soup with Crispy Carrots

Ecuadorian-style locro de papa: creamy potato and cheese soup that comes together in one pot in 20 minutes. Serve with raw carrot sticks for a fresh, crunchy contrast.

Total time
20 min
Servings
4
Calories
320
Protein
12g
Cheesy Potato Soup with Crispy Carrots
comfortcozyecuadorianvegetariancheesecreamytenderweeknight

Ingredients

  • 1.5 lbs potatoes, peeled and diced
  • 1 medium yellow onion, diced
  • 1 cup queso fresco or mozzarella, shredded
  • 1 cup whole milk
  • 3 cups vegetable broth
  • 2 medium carrots, for serving

Instructions

  1. 1

    Heat olive oil in a large pot over medium heat. Add diced onion and cook for 2 minutes until fragrant.

  2. 2

    Add diced potatoes and vegetable broth. Bring to a boil, then reduce heat and simmer for 10 minutes until potatoes are tender.

  3. 3

    Pour in milk and stir. Add cheese in handfuls, stirring until melted and soup is creamy.

  4. 4

    Season with salt and pepper to taste. Simmer 2 more minutes to blend flavors.

  5. 5

    Slice carrots into sticks. Ladle soup into bowls and serve alongside carrot sticks.

Tools you’ll need

  • large pot (3-quart)
  • cutting board
  • knife
  • wooden spoon
  • ladle

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.