CookSnap is coming soon — Join the waitlist →
Back to recipes

Cheesy Kale & Pork Skillet

Dutch stamppot boerenkool reimagined as a one-pan dinner: tender kale mashed with creamy potatoes, topped with crispy pork and melted cheese. Ready in 18 minutes.

Total time
18 min
Servings
2
Calories
620
Protein
38g
Cheesy Kale & Pork Skillet
comfortheartydutchporkcreamycrispyweeknightmain-dish

Ingredients

  • 12 oz pork shoulder or neck, cubed
  • 1 lb russet potatoes, peeled and chunked
  • 6 cups fresh kale, chopped
  • 3 tbsp butter
  • ¾ cup sharp cheddar or Gouda, shredded
  • ¼ cup whole milk

Instructions

  1. 1

    Boil potatoes in salted water until fork-tender, about 12 minutes.

  2. 2

    Meanwhile, brown pork cubes in a large skillet over medium-high heat, stirring occasionally, until no pink remains and edges crisp, ~6 minutes.

  3. 3

    Add chopped kale to the skillet with the pork and cook, stirring, until wilted, about 2 minutes.

  4. 4

    Drain potatoes and return to skillet with kale and pork.

  5. 5

    Mash roughly with a fork, then stir in butter and milk until creamy, about 1 minute.

  6. 6

    Stir in cheese until melted and fully combined, then serve immediately.

Tools you’ll need

  • large pot
  • large skillet
  • fork or potato masher
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.