Cheesy Ham Cracker Stackers
Layer crackers, cheddar, and deli ham into quick toasted stacks. Perfect grab-and-go snack that's crispy, melty, and ready in under 10 minutes.
- Total time
- 8 min
- Servings
- 2
- Calories
- 185
- Protein
- 9g
casualquickamericancrispymeltyweeknightsnackappetizer
Ingredients
- 12 count crackers
- ¾ cup cheddar cheese, sliced or shredded
- 6 slices deli ham, sliced
Instructions
- 1
Preheat oven to 375°F and line a baking sheet with foil.
- 2
Arrange 6 crackers on the baking sheet, then top each with a folded slice of ham.
- 3
Divide cheese evenly among the crackers, layering it on top of the ham.
- 4
Top each stack with a second cracker, pressing gently to hold everything together.
- 5
Bake for 4 to 5 minutes until cheese is melted and edges are lightly golden.
- 6
Serve hot and eat while the cheese is still gooey.
Tools you’ll need
- baking sheet
- foil
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
