CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Cheesy Corn Empanadas

Golden-fried corn-and-cheese hand pies bursting with fresh corn, scallions, and a touch of chili heat. Argentine humita meets weeknight dinner.

Total time
25 min
Servings
4
Calories
385
Protein
9g
Cheesy Corn Empanadas
comfortcasualargentinianvegetariancheesecrispytenderweeknight

Ingredients

  • 2 cups frozen corn
  • 1.5 cups all-purpose flour
  • ¾ cup grated mozzarella or cheese
  • 3 medium scallions, chopped
  • 1 large egg
  • 1 tbsp fresh or jarred ají (mild chili paste), optional
  • ½ cup neutral cooking oil (for frying)

Instructions

  1. 1

    Thaw corn and blot dry with paper towels. Stir corn, flour, cheese, scallions, egg, a pinch of salt, pepper, and ají (if using) until a rough dough forms.

  2. 2

    Wet your hands lightly. Scoop 2 tbsp dough, flatten into a 3-inch disc, fold in half, press edges to seal. Repeat to make 8 empanadas.

  3. 3

    Heat oil in a large skillet over medium-high until a pinch of dough sizzles on contact, about 2 minutes.

  4. 4

    Fry empanadas in two batches 2 minutes per side until golden brown and crispy. Transfer to paper towels.

  5. 5

    Serve warm with additional ají or a dollop of sour cream for dipping.

Tools you’ll need

  • large skillet
  • paper towels
  • mixing bowl
  • slotted spoon or spider

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.