CookSnap is coming soon — Join the waitlist →
Back to recipes

Cheesy Beef Zucchini Boats

Hollowed zucchini halves stuffed with seasoned ground beef, tomato, and melted cheese, then baked until golden. A Mediterranean weeknight dinner that feels fancy but takes 25 minutes.

Total time
25 min
Servings
2
Calories
385
Protein
32g
Cheesy Beef Zucchini Boats
comfortsatisfyingmediterraneanbeeftendermeltyweeknightmain-dish

Ingredients

  • 2 whole medium zucchini
  • ½ lb ground beef
  • ½ cup canned diced tomato
  • ¾ cup shredded mozzarella cheese
  • 2 cloves garlic, minced
  • ½ tsp dried oregano
  • ¼ cup parmesan cheese, grated

Instructions

  1. 1

    Halve the zucchini lengthwise. Scoop out the flesh, leaving a 1/4-inch shell. Chop the scooped flesh and set aside.

  2. 2

    Heat oil in a skillet over medium-high. Brown ground beef, breaking it up with a spoon, until no pink remains, ~5 minutes.

  3. 3

    Add garlic and cook 30 seconds until fragrant. Stir in chopped zucchini flesh, diced tomato, oregano, salt, and pepper.

  4. 4

    Simmer 3 minutes to evaporate excess liquid, stirring occasionally, then remove from heat.

  5. 5

    Arrange zucchini boats in a baking dish. Divide beef mixture evenly among them, then top each with mozzarella and parmesan.

  6. 6

    Bake at 400°F for 8 minutes until cheese melts and tops turn golden. Serve hot.

Tools you’ll need

  • sharp knife
  • spoon
  • 12-inch skillet
  • baking dish (9x13 or similar)
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.