Cheesy Bean Molletes
Split bolillo rolls topped with refried beans, melted cheese, and jalapeños, then broiled until bubbly. A classic Mexican snack ready in 10 minutes.
- Total time
- 10 min
- Servings
- 2
- Calories
- 385
- Protein
- 14g
casualsatisfyingmexicanvegetariancheesecrispymeltysnack
Ingredients
- 2 rolls bolillo rolls or French bread
- ¾ cup refried beans
- 1 cup shredded Oaxaca or mozzarella cheese
- ¼ cup pickled jalapeños, sliced
- 1 pinch salt and pepper to taste
Instructions
- 1
Position broiler rack 4 inches from heat source and preheat broiler.
- 2
Slice rolls in half lengthwise and arrange cut-side up on a broiler pan.
- 3
Spread 3 tablespoons refried beans on each roll half in an even layer.
- 4
Top each with 1/4 cup shredded cheese and 1 tablespoon jalapeños.
- 5
Broil 2–3 minutes until cheese melts and surface starts to brown.
- 6
Season with salt and pepper. Serve immediately while cheese is still hot.
Tools you’ll need
- broiler pan or baking sheet
- sharp serrated knife
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
