CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Cheesy Bean Molletes

Split bolillo rolls topped with refried beans, melted cheese, and jalapeños, then broiled until bubbly. A classic Mexican snack ready in 10 minutes.

Total time
10 min
Servings
2
Calories
385
Protein
14g
Cheesy Bean Molletes
casualsatisfyingmexicanvegetariancheesecrispymeltysnack

Ingredients

  • 2 rolls bolillo rolls or French bread
  • ¾ cup refried beans
  • 1 cup shredded Oaxaca or mozzarella cheese
  • ¼ cup pickled jalapeños, sliced
  • 1 pinch salt and pepper to taste

Instructions

  1. 1

    Position broiler rack 4 inches from heat source and preheat broiler.

  2. 2

    Slice rolls in half lengthwise and arrange cut-side up on a broiler pan.

  3. 3

    Spread 3 tablespoons refried beans on each roll half in an even layer.

  4. 4

    Top each with 1/4 cup shredded cheese and 1 tablespoon jalapeños.

  5. 5

    Broil 2–3 minutes until cheese melts and surface starts to brown.

  6. 6

    Season with salt and pepper. Serve immediately while cheese is still hot.

Tools you’ll need

  • broiler pan or baking sheet
  • sharp serrated knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.