Custrd is out on the App Store — Download it free →
Back to recipes

Cheese Fire Chicken

Crispy fried chicken coated in a spicy, cheesy sauce, served with a cool dipping sauce and garlic bread. A fun, fiery weeknight dinner.

Total time
35 min
Servings
4
Calories
650
Protein
45g
Cheese Fire Chicken
comfort foodindulgentkoreanchickencrispycreamyweeknight dinnermain

Ingredients

  • 1.5 lb chicken breast
  • 1 cup buttermilk
  • 1 cup all-purpose flour
  • 1 cup breadcrumbs
  • 2 tbsp gochujang
  • 2 tbsp honey
  • 1 cup shredded mozzarella
  • ½ cup ranch dressing

Instructions

  1. 1

    Cut the 1.5 lb chicken breast into 1-inch chunks. In a bowl, soak the chicken in 1 cup buttermilk for 15 minutes while you prep the coating.

  2. 2

    In a shallow dish, mix 1 cup flour, 1 cup breadcrumbs, 1 tsp salt, and 1 tsp black pepper. Dredge each chicken piece in the mixture, pressing to coat well.

  3. 3

    Heat 1 inch of oil in a large skillet over medium-high. Fry the chicken in batches until golden and cooked through, about 5-6 minutes per batch. Drain on paper towels.

  4. 4

    In a large bowl, stir together 2 tbsp gochujang, 2 tbsp honey, and 1 cup shredded mozzarella. Microwave in 30-second bursts, stirring, until the cheese melts into a sauce, about 1 minute total.

  5. 5

    Toss the fried chicken in the cheese sauce until fully coated. Serve hot with 0.5 cup ranch dressing for dipping.

  6. 6

    Optional: serve with garlic bread and a side of lettuce for a complete meal.

Tools you’ll need

  • large skillet
  • mixing bowls
  • shallow dish
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.