Custrd is out on the App Store — Download it free →
Back to recipes

Champ & Herb-Crusted Fish with Lime

Creamy mashed potatoes loaded with scallions, served alongside a quick pan-seared fish fillet with fresh herb crust and bright lime. A restaurant-quality Irish dinner in under 20 minutes.

Total time
18 min
Servings
2
Calories
520
Protein
38g
Champ & Herb-Crusted Fish with Lime
elegantsimpleirishfishcreamycrispytenderweeknight

Ingredients

  • 1 lb potatoes, russet or yukon gold
  • 4 stalks scallions, chopped
  • ½ cup whole milk, warmed
  • 3 tbsp butter
  • 2 fillets (6 oz each) firm white fish fillets (cod, halibut, or sea bass)
  • ¼ cup fresh herbs (parsley, dill, or chives), finely chopped
  • 1 whole lime

Instructions

  1. 1

    Cut potatoes into 1-inch chunks. Boil in salted water until fork-tender, ~12 minutes.

  2. 2

    While potatoes cook, pat fish dry and season both sides generously with salt and black pepper.

  3. 3

    Drain potatoes and return to pot. Mash with butter and warm milk until creamy, then fold in scallions.

  4. 4

    Heat 1 tbsp oil in a large skillet over medium-high until shimmering, ~90 seconds.

  5. 5

    Sear fish 3 minutes per side without moving. Sprinkle fresh herbs on top during the last 30 seconds.

  6. 6

    Divide champ between two plates, top with fish, and serve with lime wedges for squeezing.

Tools you’ll need

  • large pot
  • wooden spoon or potato masher
  • 12-inch skillet
  • knife and cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.