CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Ceviche Clásico with Cancha & Sweet Potato

Raw fish cured in fresh lime juice, served with crispy corn and roasted sweet potato—a bright, iconic Peruvian dinner that's ready in 15 minutes.

Total time
15 min
Servings
2
Calories
285
Protein
38g
Ceviche Clásico with Cancha & Sweet Potato
freshlightperuvianfishtendercrispyweeknightdinner

Ingredients

  • 1 lb sushi-grade white fish (halibut or sea bass), diced into 3/4-inch cubes
  • 4 whole fresh limes, juiced
  • ½ whole red onion, thinly sliced
  • 1 whole jalapeño, minced
  • ¾ cup cancha serrana (roasted corn kernels)
  • 1 medium sweet potato, roasted and cubed

Instructions

  1. 1

    Place diced fish in a medium bowl. Pour lime juice over it, making sure all pieces are submerged.

  2. 2

    Let sit for 8-10 minutes until the fish turns opaque and firm—the lime juice will cure it.

  3. 3

    Add salt and black pepper to taste, then gently fold in red onion and jalapeño.

  4. 4

    Divide the ceviche into two bowls. Top each with cancha and arrange roasted sweet potato on the side.

  5. 5

    Serve immediately—ceviche is best eaten fresh.

Tools you’ll need

  • medium mixing bowl
  • sharp knife
  • cutting board

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.