CookSnap is coming soon — Join the waitlist →
Back to recipes

Caramelized Grilled Pineapple with Lime & Chili

Charred pineapple wedges get a sticky-sweet glaze with lime juice, brown sugar, and a whisper of chili heat. Serve hot with coconut yogurt and crispy rice cereal for the ultimate Hawaiian weeknight dessert or side.

Total time
15 min
Servings
2
Calories
185
Protein
3g
Caramelized Grilled Pineapple with Lime & Chili
refreshingsimplehawaiianvegetarianvegangluten-freecrispyjuicy

Ingredients

  • 1 medium, peeled, cored, cut into 8 wedges fresh pineapple
  • 2 tbsp brown sugar
  • 1 whole fresh lime (juiced)
  • ¼ tsp red chili flakes
  • ½ cup coconut yogurt or Greek yogurt
  • ¼ cup crispy rice cereal or toasted coconut flakes

Instructions

  1. 1

    Pat pineapple wedges dry with a paper towel. Brush with olive oil and sprinkle salt on both sides.

  2. 2

    Heat a grill pan or outdoor grill to medium-high until water flicks sizzle on contact, ~2 minutes.

  3. 3

    Lay pineapple wedges on the grill and cook 3 minutes without moving until deep char marks appear.

  4. 4

    Flip each wedge and cook 2 more minutes on the other side until caramelized and juices pool at the edges.

  5. 5

    Transfer pineapple to a plate. Drizzle with lime juice, sprinkle brown sugar and chili flakes while still hot.

  6. 6

    Serve warm with a dollop of coconut yogurt and a handful of crispy rice cereal sprinkled on top.

Tools you’ll need

  • grill pan or outdoor grill
  • paper towels
  • tongs or spatula
  • small plate
  • spoon for drizzling

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.