CookSnap is coming soon — Join the waitlist →
Back to recipes

Cajun Shrimp Boil

Shrimp, smoked sausage, and potatoes tossed with butter and Cajun spice in one skillet. No boiling pot, no draining—just dump, sear, and eat straight from the pan.

Total time
15 min
Servings
2
Calories
520
Protein
48g
Cajun Shrimp Boil
casualsatisfyingcajunshrimptendercrispyweeknightmain-dish

Ingredients

  • ¾ lb small waxy potatoes (like red or fingerling)
  • 8 oz smoked sausage, halved lengthwise then cut into 1-inch pieces
  • 1 lb large shrimp, peeled and deveined
  • 4 tbsp butter
  • 2 tbsp Cajun seasoning (or 1 tsp paprika + 0.5 tsp cayenne + 0.5 tsp garlic powder + 0.5 tsp dried thyme + salt + black pepper)
  • 1 whole lemon (halved)

Instructions

  1. 1

    Slice potatoes into 1/4-inch rounds. You want thin so they cook fast.

  2. 2

    Melt butter in a large skillet over medium-high heat until it foams, about 90 seconds.

  3. 3

    Add potatoes and sausage. Stir and cook until potatoes are fork-tender, 8–10 minutes.

  4. 4

    Push potatoes and sausage to the sides. Add shrimp and Cajun seasoning to the center of the skillet.

  5. 5

    Toss everything together. Cook 2–3 minutes until shrimp are opaque and pink, not translucent.

  6. 6

    Squeeze lemon over the top. Serve straight from the skillet with crusty bread.

Tools you’ll need

  • 12-inch skillet with high sides (cast iron preferred)
  • cutting board
  • chef's knife
  • wooden spoon or silicone spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.