CookSnap is coming soon — Join the waitlist →

Butter-Laminated Danish Pastry Board

A TikTok-friendly cheat on wienerbrød using puff pastry, cinnamon sugar, and quick lamination. Layer, swirl, bake, and share—no overnight proofing required.

Total time
25 min
Servings
4
Calories
285
Protein
3g
Butter-Laminated Danish Pastry Board
indulgentcozyscandinavianvegetariancrispyflakybutteryweekend

Ingredients

  • 1 package (2 sheets, 17.3 oz) Thawed puff pastry sheets
  • 3 tbsp Unsalted butter, softened
  • 1.5 tsp Cinnamon
  • 3 tbsp Granulated sugar
  • 1 large Egg, beaten
  • ½ tsp Fleur de sel or coarse sugar

Instructions

  1. 1

    Heat oven to 400°F. Line a sheet pan with parchment paper.

  2. 2

    Lay puff pastry sheets on a work surface. Spread 1.5 tbsp softened butter evenly over each sheet.

  3. 3

    Whisk cinnamon and sugar together, then sprinkle half the mixture over each buttered sheet.

  4. 4

    Roll each sheet tightly from the long side into a log. Slice logs into 1-inch rounds.

  5. 5

    Arrange rounds cut-side up on the sheet pan. Brush with beaten egg, then sprinkle with fleur de sel.

  6. 6

    Bake until puffed and golden brown, 12–15 minutes. Cool 2 minutes before serving.

Tools you’ll need

  • sheet pan
  • parchment paper
  • oven
  • work surface (cutting board or counter)
  • butter knife or offset spatula
  • small bowl
  • whisk
  • serrated knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.