CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Buddha Jumps Over Broth

A streamlined weeknight version of the legendary Chinese stew: chicken, shrimp, and mushrooms braised in a deeply savory ginger-soy broth with just enough time to build real flavor. Served bubbling hot over rice.

Total time
25 min
Servings
4
Calories
320
Protein
42g
Buddha Jumps Over Broth
heartycomfortchinesechickenshrimptendersilkyweeknight

Ingredients

  • 1 lb boneless chicken thighs, cut into 1-inch pieces
  • ½ lb large shrimp, peeled and deveined
  • 6 oz fresh shiitake mushrooms, halved
  • 3 cups chicken stock
  • 3 tbsp soy sauce
  • 2 inch piece fresh ginger, sliced thin (about 3 tbsp)
  • ¼ cup dried shiitake mushrooms or lily buds (optional texture)
  • 3 stalks scallions, sliced into 1-inch pieces

Instructions

  1. 1

    Bring stock to a gentle boil in a large pot over medium-high heat.

  2. 2

    Add soy sauce, ginger slices, and dried mushrooms if using. Simmer 3 minutes until fragrant.

  3. 3

    Add chicken pieces, fresh shiitake, and shrimp. Stir gently to submerge.

  4. 4

    Simmer uncovered for 8–10 minutes until chicken is opaque and shrimp turns pink.

  5. 5

    Stir in scallions. Taste and adjust salt or soy sauce if needed.

  6. 6

    Ladle into bowls over steamed rice. Serve immediately while the broth is still steaming.

Tools you’ll need

  • large pot (4-quart or larger)
  • wooden spoon or ladle
  • knife for slicing
  • bowls for serving

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.