Bruschetta Pomodoro
Toasted bread topped with fresh tomatoes, garlic, basil, and olive oil — a classic Italian appetizer or light dinner. Ready in 15 minutes.
- Total time
- 15 min
- Servings
- 4
- Calories
- 185
- Protein
- 4g
freshsimpleitalianvegetariancrispyjuicyweeknightappetizer
Ingredients
- 1 loaf ciabatta or Italian bread
- 4 medium tomatoes, ripe
- 3 cloves garlic, peeled
- 8 leaves fresh basil
- 3 tbsp olive oil
- 1 to taste salt and pepper
Instructions
- 1
Slice bread into 1/3-inch-thick diagonal pieces.
- 2
Dice tomatoes into 1/2-inch pieces; place in a small bowl.
- 3
Mince garlic and tear basil leaves by hand.
- 4
Brush both sides of bread with 1.5 tbsp olive oil.
- 5
Toast bread in a skillet over medium-high until golden, ~90 seconds per side.
- 6
Rub each hot toast with a cut garlic clove until fragrant.
- 7
Toss tomatoes with remaining 1.5 tbsp olive oil, basil, salt, and pepper.
- 8
Spoon tomato mixture onto each toast and serve immediately.
Tools you’ll need
- serrated knife
- cutting board
- small bowl
- 12-inch skillet
- brush or small spoon
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
