CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Brie with Jam Crostini

Crispy bread topped with melted brie and sweet jam—ready in 10 minutes. A sophisticated snack that feels special but requires minimal effort.

Total time
10 min
Servings
2
Calories
185
Protein
6g
Brie with Jam Crostini
elegantquickitalianvegetariancrispymeltyappetizerparty

Ingredients

  • ½ loaf baguette
  • 4 oz brie cheese
  • 3 tbsp jam (fig, apricot, or raspberry)
  • 1 tbsp olive oil

Instructions

  1. 1

    Slice baguette diagonally into 0.5-inch-thick pieces. Brush both sides lightly with olive oil.

  2. 2

    Arrange slices on a baking sheet and broil 3–4 inches from heat until golden, about 2 minutes per side.

  3. 3

    Top each warm slice with a 0.5-inch slice of brie, then 0.5 tsp jam.

  4. 4

    Return to broiler for 60–90 seconds until cheese melts and looks glossy.

  5. 5

    Serve immediately while brie is still soft.

Tools you’ll need

  • baking sheet
  • broiler
  • serrated knife
  • pastry brush

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.