Brie with Jam Crostini
Crispy bread topped with melted brie and sweet jam—ready in 10 minutes. A sophisticated snack that feels special but requires minimal effort.
- Total time
- 10 min
- Servings
- 2
- Calories
- 185
- Protein
- 6g

elegantquickitalianvegetariancrispymeltyappetizerparty
Ingredients
- ½ loaf baguette
- 4 oz brie cheese
- 3 tbsp jam (fig, apricot, or raspberry)
- 1 tbsp olive oil
Instructions
- 1
Slice baguette diagonally into 0.5-inch-thick pieces. Brush both sides lightly with olive oil.
- 2
Arrange slices on a baking sheet and broil 3–4 inches from heat until golden, about 2 minutes per side.
- 3
Top each warm slice with a 0.5-inch slice of brie, then 0.5 tsp jam.
- 4
Return to broiler for 60–90 seconds until cheese melts and looks glossy.
- 5
Serve immediately while brie is still soft.
Tools you’ll need
- baking sheet
- broiler
- serrated knife
- pastry brush
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.



