CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Bratkartoffeln

Crispy German pan-fried potatoes with onions and bacon, finished with fresh parsley. A rustic, one-pan side or light main that comes together in under 40 minutes.

Total time
35 min
Servings
4
Calories
385
Protein
14g
Bratkartoffeln
comfortrusticgermaneggscrispytenderweeknightdinner

Ingredients

  • 2 lbs potatoes, waxy (such as Yukon Gold)
  • 6 oz bacon, chopped
  • 1 medium onion, yellow, sliced thin
  • 2 cloves garlic, minced
  • ¾ tsp salt
  • ¼ tsp black pepper
  • 2 tbsp fresh parsley, chopped

Instructions

  1. 1

    Cut potatoes into 3/4-inch cubes. Place in a pot of cold salted water.

  2. 2

    Bring to a boil, then reduce heat. Simmer 8–10 minutes until just tender but still holding shape.

  3. 3

    Drain potatoes well in a colander. Spread on a clean kitchen towel to cool and dry.

  4. 4

    In a 12-inch skillet over medium-high, cook bacon until crispy, 5–6 minutes. Transfer to a plate.

  5. 5

    Add onion to the bacon fat. Cook, stirring occasionally, until golden and soft, 4–5 minutes.

  6. 6

    Add garlic and stir until fragrant, about 30 seconds.

  7. 7

    Add dried potatoes to the skillet in a single layer. Do not stir for 3 minutes—let them brown.

  8. 8

    Stir and spread into an even layer again. Cook until golden and crispy, 4–5 minutes more.

  9. 9

    Taste and season with salt and pepper. Return bacon to the skillet and toss gently to combine.

  10. 10

    Transfer to a serving dish. Garnish with fresh parsley and serve immediately.

Tools you’ll need

  • large pot
  • 12-inch skillet
  • colander
  • kitchen towel
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.