Biscoff Spread Toast
Crispy toast topped with creamy Biscoff spread, banana slices, and a drizzle of honey. Ready in 5 minutes—the ultimate sweet snack.
- Total time
- 5 min
- Servings
- 2
- Calories
- 285
- Protein
- 6g

casualindulgentvegetariancrispycreamysnacktoastsnack
Ingredients
- 2 slices bread
- 3 tbsp Biscoff spread
- ½ whole banana
- 1 tsp honey
Instructions
- 1
Toast bread until golden brown and edges curl slightly, about 2 minutes.
- 2
Spread 1.5 tbsp Biscoff on each warm slice, letting it soften slightly.
- 3
Slice banana into thin rounds and arrange over the spread.
- 4
Drizzle with honey and serve immediately.
Tools you’ll need
- toaster
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.



