CookSnap is coming soon — Join the waitlist →
Back to recipes

Beijing Stew with Chicken & Shrimp

A quick, warming Chinese stew with tender chicken and shrimp in a ginger-soy broth, finished with crispy garlic and fresh greens. Ready in 20 minutes.

Total time
20 min
Servings
4
Calories
285
Protein
42g
Beijing Stew with Chicken & Shrimp
comfortcozychinesechickenshrimptendersilkyweeknight

Ingredients

  • ¾ lb boneless chicken thighs
  • ½ lb large shrimp, peeled and deveined
  • 3 tbsp ginger, sliced into thin coins
  • 4 tbsp soy sauce
  • 6 cups chicken broth
  • 8 oz baby bok choy, halved lengthwise
  • 2 tbsp chili oil (or sesame oil mixed with chili flakes)

Instructions

  1. 1

    Cut chicken thighs into 1-inch pieces. Heat oil in a large pot over medium-high heat.

  2. 2

    Add ginger slices and stir for 30 seconds until fragrant. Pour in soy sauce and broth.

  3. 3

    Bring to a boil, then add chicken pieces. Simmer for 8 minutes until cooked through.

  4. 4

    Add shrimp and bok choy to the pot. Simmer for 3 minutes until shrimp is pink and bok choy is tender.

  5. 5

    Taste and adjust seasoning with salt and soy sauce if needed. Drizzle chili oil over the top.

  6. 6

    Serve hot in bowls, dividing broth, protein, and greens equally among portions.

Tools you’ll need

  • large pot (4-quart or larger)
  • cutting board
  • chef's knife
  • wooden spoon or ladle

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.