CookSnap is coming soon — Join the waitlist →
Back to recipes

Beijing Sesame Paste Noodles

Nutty sesame paste coats chewy noodles in this classic Beijing street food—ready in under 15 minutes. Topped with cucumber and scallions for a light, satisfying vegetarian meal.

Total time
12 min
Servings
2
Calories
385
Protein
12g
Beijing Sesame Paste Noodles
simplequickchinesevegetarianvegetarianchewyweeknightpasta

Ingredients

  • 6 oz Chinese egg noodles or ramen noodles
  • 3 tbsp sesame paste (tahini)
  • 2 tbsp soy sauce
  • 1 tbsp rice vinegar
  • 1 medium cucumber, thinly sliced
  • 3 tbsp scallions, thinly sliced

Instructions

  1. 1

    Bring a pot of salted water to boil. Add noodles and cook until al dente, ~3 minutes.

  2. 2

    Reserve 1/4 cup cooking water, then drain noodles into a colander.

  3. 3

    Whisk sesame paste, soy sauce, and rice vinegar together in a small bowl.

  4. 4

    Add reserved cooking water to the sesame mixture a splash at a time until smooth and pourable.

  5. 5

    Toss warm noodles with the sesame sauce until evenly coated.

  6. 6

    Divide into bowls. Top with cucumber and scallions. Serve at room temperature or chilled.

Tools you’ll need

  • pot (3-quart minimum)
  • small bowl
  • whisk
  • colander

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.