CookSnap is in beta — Get it free on TestFlight →
Back to recipes

25-Min Beef Ragù Pappardelle

Ground beef simmered fast with tomato and aromatics, tossed with wide pappardelle pasta. Paired with a bright cherry tomato salad and a glass of red wine for an easy weeknight Italian dinner.

Total time
25 min
Servings
2
Calories
620
Protein
28g
25-Min Beef Ragù Pappardelle
comfortcozyitalianbeeftendercreamyweeknightdinner

Ingredients

  • ½ lb ground beef
  • ½ medium yellow onion
  • 1 can (14.5 oz) canned crushed tomatoes
  • 8 oz pappardelle pasta
  • 1 cup cherry tomatoes
  • 2 cups fresh arugula

Instructions

  1. 1

    Dice the onion into small pieces. Heat oil in a large skillet over medium-high heat until shimmering, about 90 seconds.

  2. 2

    Add onion to the skillet and cook, stirring, until softened and translucent, about 3 minutes.

  3. 3

    Add ground beef to the skillet and brown, breaking it up with a spoon, until no pink remains, about 4 minutes.

  4. 4

    Pour in crushed tomatoes with their juice and stir. Simmer for 8 minutes until the sauce thickens and deepens in color.

  5. 5

    While the ragù simmers, boil salted water in a separate pot and cook pappardelle until al dente, about 9 minutes.

  6. 6

    Drain pasta and toss with ragù. In a bowl, dress arugula and cherry tomatoes with oil, salt, and pepper. Serve ragù alongside the salad.

Tools you’ll need

  • large skillet (12-inch)
  • large pot
  • wooden spoon
  • colander
  • serving bowl

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.