CookSnap is coming soon — Join the waitlist →
Back to recipes

20-Min Barszcz — Polish Beet Soup with Crispy Bread

Clear, vibrant beet broth simmered with vinegar and garlic, served with crispy flatbread, fresh radish, and a squeeze of lemon. A soulful Polish classic that tastes like it simmered for hours but comes together in 20 minutes.

Total time
20 min
Servings
2
Calories
145
Protein
4g
20-Min Barszcz — Polish Beet Soup with Crispy Bread
comfortwholesomepolishvegetariandairy-freesilkytenderweeknight

Ingredients

  • 3 whole beets, medium, peeled and grated
  • 4 cups vegetable or chicken broth
  • 2 tbsp white vinegar
  • 2 cloves garlic, minced
  • 2 pieces flatbread or naan
  • 1 of each lemon, radish, fresh parsley (for serving)

Instructions

  1. 1

    Heat broth in a large pot over medium-high until steaming, about 2 minutes.

  2. 2

    Add grated beets and minced garlic. Simmer for 12 minutes, stirring occasionally.

  3. 3

    Stir in vinegar and a pinch of salt. Taste and adjust seasoning—the broth should taste bright and tangy.

  4. 4

    While soup simmers, warm flatbread in a dry skillet over medium heat for 1 minute per side until pliable.

  5. 5

    Strain soup through a fine-mesh sieve into serving bowls, pressing gently on solids to extract all liquid.

  6. 6

    Serve hot with flatbread, a wedge of lemon, thinly sliced radish, and a pinch of fresh parsley.

Tools you’ll need

  • large pot (3-quart or bigger)
  • fine-mesh sieve or strainer
  • box grater or food processor
  • skillet or griddle

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.