CookSnap is coming soon — Join the waitlist →
Back to recipes

Barolo Risotto with Braised Beef

Creamy arborio rice infused with Barolo wine and beef broth, topped with fall-apart tender braised beef chuck. A luxurious one-pot Italian supper that looks restaurant-worthy but is entirely achievable at home.

Total time
95 min
Servings
4
Calories
725
Protein
48g
Barolo Risotto with Braised Beef
comfortelegantitalianbeefcreamytenderweeknightdate-night

Ingredients

  • 1.25 lbs beef chuck, cut into 1.5-inch cubes
  • 1 to taste salt and pepper
  • 3 tbsp olive oil
  • 1 medium yellow onion, diced
  • 1.5 cups arborio rice
  • 1.5 cups Barolo wine (or other dry red wine)
  • 4 cups beef broth
  • 3 tbsp butter + 0.5 cup cheese butter and grated Parmigiano-Reggiano

Instructions

  1. 1

    Pat beef dry with paper towels. Season generously with salt and black pepper on all sides.

  2. 2

    Heat 2 tbsp olive oil in a large heavy pot over medium-high until it shimmers, about 90 seconds.

  3. 3

    Working in batches, sear beef 2–3 minutes per side without moving. Transfer to a plate.

  4. 4

    Add 1 tbsp oil to the pot. Cook diced onion, stirring, until soft and translucent, about 4 minutes.

  5. 5

    Pour in Barolo, scraping up any browned bits from the bottom. Return beef and any juices to the pot.

  6. 6

    Add 3 cups beef broth. Bring to a simmer, then reduce heat to medium-low. Cover partially.

  7. 7

    Braise 60 minutes, until beef is fork-tender and liquid is reduced by half, stirring occasionally.

  8. 8

    Warm the remaining 1 cup broth in a separate saucepan over low heat.

  9. 9

    Using a slotted spoon, transfer braised beef from the pot to a plate. Keep braising liquid in the pot.

  10. 10

    Add arborio rice directly to the braising liquid and stir constantly for 2 minutes to toast lightly.

  11. 11

    Add warm broth 1 cup at a time, stirring frequently and waiting until liquid is absorbed before adding more, ~18 minutes total.

  12. 12

    Rice is done when creamy but grains are still firm to bite. Stir in butter and Parmigiano-Reggiano until glossy.

  13. 13

    Return braised beef to the pot and stir gently. Season with salt and pepper to taste.

  14. 14

    Divide risotto and beef between bowls. Serve immediately.

Tools you’ll need

  • large heavy pot with lid (5-quart minimum)
  • wooden spoon or silicone spatula
  • slotted spoon
  • small saucepan
  • tongs
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.