CookSnap is coming soon — Join the waitlist →
Back to recipes

Bánh Dá Lợn (Crispy Tapioca Cake)

Crispy, chewy Vietnamese tapioca cake with layers of savory pork and shallot filling, finished with a drizzle of salty fish sauce and fresh herbs. Golden-fried and served warm.

Total time
50 min
Servings
4
Calories
312
Protein
4g
Bánh Dá Lợn (Crispy Tapioca Cake)
satisfyingrusticvietnamesevegetarianvegetariancrispychewyweeknight

Ingredients

  • 1.5 cups tapioca starch
  • 1 cup boiling water
  • ½ tsp salt
  • 8 oz shiitake mushrooms, finely chopped
  • 3 oz shallots, thinly sliced
  • 2 cloves garlic, minced
  • 1.5 tbsp fish sauce
  • ½ tsp sugar
  • 3 tbsp olive oil, divided
  • ¼ cup fresh cilantro, chopped
  • 1 whole lime (halved)
  • ¼ tsp black pepper

Instructions

  1. 1

    Heat 1.5 tbsp oil in a skillet over medium-high. Add shallots and cook until softened and lightly golden, ~4 minutes.

  2. 2

    Add garlic and cook for 30 seconds until fragrant.

  3. 3

    Add mushrooms and cook, stirring, until liquid evaporates and edges brown, ~6 minutes.

  4. 4

    Stir in fish sauce and sugar. Remove from heat and cool to room temperature.

  5. 5

    Pour boiling water into tapioca starch and salt. Stir until a sticky, uniform dough forms, ~2 minutes.

  6. 6

    Let cool for 5 minutes until you can handle it. The dough should be warm, pliable, and slightly sticky.

  7. 7

    Divide dough into 4 equal pieces. Flatten one piece into a 5-inch round on plastic wrap.

  8. 8

    Spread 2 tbsp filling onto the round, leaving a 0.5-inch border. Fold sides up and seal into a rectangle or square.

  9. 9

    Repeat with remaining dough and filling to make 4 cakes.

  10. 10

    Heat remaining 1.5 tbsp oil in a large skillet over medium-high until shimmering.

  11. 11

    Pan-fry cakes 3–4 minutes per side until edges are golden and crispy. Do not move cakes while frying.

  12. 12

    Transfer to a plate. Sprinkle with cilantro, black pepper, and a squeeze of lime. Serve warm.

Tools you’ll need

  • large mixing bowl
  • wooden spoon or spatula
  • 12-inch skillet
  • plastic wrap
  • cutting board
  • chef's knife
  • measuring cups and spoons

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.