CookSnap is coming soon — Join the waitlist →

Bakery-Style Chocolate Chunk Cookies

Thick, chewy cookies with crispy edges and melty chocolate chunks, just like a professional bakery. Brown butter and a hint of vanilla extract give these an elevated, buttery flavor that's hard to resist.

Total time
35 min
Servings
12
Calories
320
Protein
3g
Bakery-Style Chocolate Chunk Cookies
indulgentcomfortvegetariancrispychewymeltydessertholiday

Ingredients

  • ¾ cup (1.5 sticks) butter
  • ¾ cup granulated sugar
  • ¾ cup brown sugar, packed
  • 1 whole large egg
  • 1.5 tsp vanilla extract
  • 2.25 cups all-purpose flour
  • 1 tsp baking soda
  • 1 tsp salt
  • 2 cups semi-sweet chocolate chunks
  • ¼ tsp fleur de sel or sea salt (topping)

Instructions

  1. 1

    Melt butter in a light-colored saucepan over medium heat, swirling often, until it turns amber with a nutty aroma, ~8 minutes.

  2. 2

    Pour browned butter into a bowl, then chill in the freezer for 10 minutes until it cools but is still liquid.

  3. 3

    Whisk together granulated sugar, brown sugar, and cooled browned butter until combined.

  4. 4

    Beat in the egg until fully incorporated, then add vanilla extract and stir.

  5. 5

    Combine flour, baking soda, and salt in a separate bowl, then whisk to blend.

  6. 6

    Fold dry ingredients into the wet mixture using a spatula until just combined, being careful not to overmix.

  7. 7

    Fold in chocolate chunks until evenly distributed throughout the dough.

  8. 8

    Cover the bowl with plastic wrap and refrigerate the dough for at least 30 minutes.

  9. 9

    Preheat oven to 375°F. Line two baking sheets with parchment paper.

  10. 10

    Scoop dough into 2-tablespoon portions and space them 2 inches apart on the prepared sheets.

  11. 11

    Bake for 11–13 minutes until edges are golden brown but centers still look slightly underdone.

  12. 12

    Remove from oven and immediately sprinkle a tiny pinch of fleur de sel on each warm cookie.

  13. 13

    Let cookies cool on the baking sheet for 5 minutes, then transfer to a wire rack to cool completely.

Tools you’ll need

  • light-colored saucepan
  • whisk
  • large mixing bowl
  • separate mixing bowl
  • spatula
  • plastic wrap
  • baking sheets
  • parchment paper
  • cookie scoop or 2-tablespoon spoon
  • wire cooling rack

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.