20-Min Baked Ziti with Garlic Bread
Cooked ziti tossed with marinara and mozzarella, then baked until bubbly—finished with crispy garlic bread on the side. A weeknight Italian comfort meal ready in under 20 minutes.
- Total time
- 20 min
- Servings
- 4
- Calories
- 520
- Protein
- 22g
comfortcasualitalianvegetariancreamymeltyweeknightpasta
Ingredients
- 1 lb ziti pasta
- 24 oz marinara sauce
- 2 cups mozzarella cheese, shredded
- 1 piece garlic bread (store-bought or homemade)
Instructions
- 1
Boil ziti in salted water until al dente, about 8–10 minutes, then drain.
- 2
Toss hot pasta with marinara sauce and 1.5 cups mozzarella in a large bowl.
- 3
Pour mixture into a 9x13-inch baking dish, top with remaining 0.5 cup cheese.
- 4
Bake at 375°F until cheese melts and edges bubble, about 8–10 minutes.
- 5
Bake garlic bread alongside the ziti in the final 3 minutes, until golden.
- 6
Serve baked ziti hot with garlic bread on the side.
Tools you’ll need
- large pot
- 9x13-inch baking dish
- large mixing bowl
- oven
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
