CookSnap is coming soon — Join the waitlist →

Baked Gnocchi with Mozzarella & Tomato

Pillowy gnocchi tossed with bright tomato sauce, fresh mozzarella, and basil, then baked until bubbly and golden. A weeknight Italian comfort dish that tastes like you spent hours but takes under 30 minutes.

Total time
25 min
Servings
4
Calories
520
Protein
22g
Baked Gnocchi with Mozzarella & Tomato
comfortitalianvegetariancheesecreamytendermeltyweeknight

Ingredients

  • 1.5 lbs gnocchi (fresh or frozen, shelf-stable)
  • 28 oz whole peeled tomatoes (canned)
  • 8 oz fresh mozzarella, torn into bite-sized pieces
  • ½ cup fresh basil leaves
  • 3 cloves garlic cloves, minced
  • ½ cup parmesan, grated

Instructions

  1. 1

    Preheat oven to 425°F. Boil gnocchi in salted water until they float and hold for 30 seconds, then drain.

  2. 2

    Heat olive oil in a skillet over medium. Cook garlic 30 seconds until fragrant, then add canned tomatoes.

  3. 3

    Simmer sauce 5 minutes, breaking up tomatoes with a spoon. Season with salt and pepper to taste.

  4. 4

    Toss drained gnocchi with tomato sauce and half the basil. Transfer to a baking dish.

  5. 5

    Scatter mozzarella and parmesan over the top. Bake uncovered until cheese melts and edges bubble, 8-10 minutes.

  6. 6

    Serve hot, garnished with remaining fresh basil and a drizzle of olive oil.

Tools you’ll need

  • large pot
  • colander
  • 12-inch skillet
  • wooden spoon
  • 9x13-inch baking dish
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.